PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G252300.1
Common NameB456_010G252300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 74aa    MW: 8350.39 Da    PI: 8.5241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G252300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.8e-122567145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        + r++++E+ l+++ +++ G + W++Ia +++ gRt++++  +w+
  Gorai.010G252300.1 25 KVRFSEDEEMLIARMFNLVGQR-WSLIAGRIP-GRTAEEIEKYWR 67
                        679******************9.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2712073IPR017930Myb domain
SMARTSM007172.0E-92472IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-92571IPR009057Homeodomain-like
PfamPF002497.9E-112568IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-122768IPR009057Homeodomain-like
CDDcd001671.90E-82767No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MGDFDGHGSS NGCTSHDSKL KDKTKVRFSE DEEMLIARMF NLVGQRWSLI AGRIPGRTAE  60
EIEKYWRSKH NPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529738.16e-26PREDICTED: MYB-like transcription factor ETC1
RefseqXP_016487460.12e-25PREDICTED: MYB-like transcription factor ETC3 isoform X1
SwissprotO220599e-18CPC_ARATH; Transcription factor CPC
TrEMBLA0A0D2VF868e-50A0A0D2VF86_G
STRINGVIT_12s0059g02360.t014e-23(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-19MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]